DPCstruct | MC62772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 53.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6VLH9 | 3-83 | FVAGALDGNISLGCNPATWKAYVSCFVGLLVTFAPAWIQEVELETLKKLAHGLRGWHECELALSLLERGGFASMGFVAETL |
| A0A427ANN9 | 385-466 | DFLSSVLDGKISLGCNWVLWRAYVSGFLGLVVQCAPYWVLEVDLHILKKLSQGLRRWKEDELALALLKRGGVEAMGAAAEVI |
| V4LI35 | 715-810 | None |
| A0A1D6F4J1 | 558-647 | None |
| A0A7N0REU2 | 28-117 | None |
| A0A0V0IBP8 | 316-413 | None |
| A0A438H5H1 | 266-355 | None |
| A0A3B6RB86 | 205-294 | None |
| A0A0A9HGW3 | 139-228 | None |
| A0A392NNZ4 | 87-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.