DPCstruct | MC6277
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 9.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 70.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6DWB8 | 2-84 | AENERARRELQQKQHYFLQSELQSLSRDLPGKFQQRLPYDLLSSLANALLDGTVFEIVRSLQEVQHLEEKHLSSQRMKLINDH |
| A0A6J1YMQ3 | 32-135 | MERYGGAFEEAVDGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQN… |
| A0A2I3GSX9 | 1-92 | None |
| A0A6F9DBE4 | 2-94 | None |
| A0A4Z2J818 | 13-93 | None |
| A0A821LAF7 | 12-89 | None |
| A0A2R8Z6E4 | 1-102 | None |
| A0A4Y7NJI8 | 7-90 | None |
| A0A6J0GE40 | 15-100 | None |
| A0A672P6S0 | 11-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.