DPCstruct | MC62768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 328 ± 33 aa |
| Standard deviation of domain lengths | 32.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0X1F3 | 1-333 | MHLIKKSGIGSHDKSLEGAAFGLYRPAAELRAVFVNNPGRARASCRWFRENKAKQGGCDQPILLGNDPLYGGLGGEFTVITASELNG… |
| A0A550BWR0 | 32-359 | YALALEITGNQTFNTVKPLLNIWAAFSPSGESGLGQDGVLKDTPFGLYRNGTELRAVYYGKPEVADAACKSLGSQCDYPILLGNSPL… |
| A0A4S4L423 | 278-557 | None |
| G4TJ96 | 67-327 | None |
| A0A507FJ42 | 184-519 | None |
| F0YCQ9 | 40-417 | None |
| W4F910 | 1-336 | None |
| A0A226D198 | 663-974 | None |
| A0A2D4CFS6 | 756-1091 | None |
| A0A2D4CDF3 | 186-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.