DPCstruct | MC62761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 209 ± 24 aa |
| Standard deviation of domain lengths | 23.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GLN4 | 10-213 | MEVHPDQSTCKDPVKVRNPEGRPQRCLRPMPSEPFLKVYNCEYIRPPRPDRFDRAMKQIYRPNHVWSHFVHYSTVTAGVARYFKDFP… |
| A0A7S4T5W9 | 394-616 | MGNYTSMKDVLLDAEKKGTNILDFRSTRAYPLHEFTEPYSDERECGSSNNPLCRVKRSDALFLETYNCDFVPTPKPSWADRARKQIY… |
| A0A7R9WUI4 | 45-265 | None |
| K0RJV6 | 752-966 | None |
| A0A7S1E089 | 1-155 | None |
| A0A7S4N7W6 | 162-407 | None |
| A0A7S0PX50 | 25-252 | None |
| A0A7R9WSP8 | 10-192 | None |
| A0A1E7EK63 | 571-791 | None |
| A0A522DPX0 | 63-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.