DPCstruct | MC62759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 128 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1GR11 | 1-119 | SVVSQDTQTVTFTVSQLWKGCEAKESSAVSWLAIDFISDEGELICSKASNVPCGEVETFTAACEDGLTVVDIYAYDASGTVFKSDEE… |
| A0A7S1D6I9 | 1-146 | PVDTCGAKSGEEPVKIISQDGDTVTFALSQVWKGCDSSGTKMSWIAADYVSRDDELTCTKFSDLACGHATTITAQCDDGATVLDIYT… |
| A0A7S1GMQ4 | 756-912 | None |
| A0A6U1NPH5 | 463-596 | None |
| A0A7R9WZP9 | 655-772 | None |
| A0A7S3LAR1 | 139-248 | None |
| A0A1E7F284 | 14-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.