DPCstruct | MC6274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 151 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 14.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C7R6D4 | 2-124 | QAKAWLAELSVKADIYSYILYFGADSLGTDGFDAGLDVTCPPPGPTFYSYFWIDTLPYYLSTDIRASTDDSITWILKIVNATGLIDT… |
| A0A6N6T9R4 | 2-149 | RLIAEEPTLNMRSRNNVFGQLLDSAAGYDEHDLPKLAPFGTPYLTVVFPHPDWGLKAGDYASDYRPNRETRGRGLPAANWRFEIRTD… |
| A0A1V1P2Y5 | 7-166 | None |
| A0A1V1P142 | 3-127 | None |
| A0A1V1NUU8 | 21-172 | None |
| A0A1V1NU28 | 9-145 | None |
| A0A1V1NSP4 | 6-141 | None |
| A0A2A4YNX4 | 650-792 | None |
| A0A1F6ZDQ0 | 101-292 | None |
| A0A348XL77 | 37-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.