DPCstruct | MC62732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 11 aa |
| Standard deviation of domain lengths | 11.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7PVW5 | 1-126 | MSTYVIVEELGDWPCHANYLLTARTYLQHGVPTTGGRPRIINLCRNLEHLSAGYYCSLLAQARSHHCLPGLQAISVLQPQQPPAKLW… |
| W0BBE7 | 1-141 | MQTVLITDDPQSWSFLSSLAPIIQASDYLSNDSYHQTQTMRIINLCRSYDYQTIGYYVSLLAQARDHKAIPSALNIQDVLSTSLTKQ… |
| A0A7V8VTP7 | 5-166 | None |
| A0A2W5MYE9 | 17-153 | None |
| A0A3M3D1T9 | 130-261 | None |
| A0A433J5R6 | 102-237 | None |
| T1BC35 | 1-154 | None |
| A0A2E9IXG6 | 5-147 | None |
| A0A3D4P9Z3 | 163-293 | None |
| A0A060UT25 | 5-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.