DPCstruct | MC62731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 152 ± 28 aa |
| Standard deviation of domain lengths | 27.92 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D2EQK9 | 13-166 | KGDVLSGFTDEVVKNILIDYYQNNLKLNEIIKKYSIHTIASNLRKEFPKVSTSFICEICGEEKYIQLPTKRDYDKLVNNDQLDNYFV… |
| A0A1C2NZF2 | 1-132 | MFYIHNFNLNTISPSLEHLNKEQIVQLVNEYYDGIKVNELIEKYELDIIASKLVSVFPLIKINIKCEFCNVHLITKLKSKSSYQQFS… |
| A0A6S5Y3B0 | 1-205 | None |
| A0A2N6QVX2 | 2-154 | None |
| A0A0H4QGX8 | 4-135 | None |
| W7CR49 | 12-137 | None |
| A0A7Y0FTD0 | 5-192 | None |
| H1LHC8 | 5-147 | None |
| A0A0H4QKF9 | 13-163 | None |
| A0A1X1HE20 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.