DPCstruct | MC62728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 224 ± 27 aa |
| Standard deviation of domain lengths | 27.15 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B2D1U7 | 1-253 | MQDVEAALTVLRDAAETETRRSAASVLASTALLQNGRLDGLVVLVSQVQLVWRIARIYGLRPSLRQLSYLYGNVGACVLVAYGLDEV… |
| A0A7X6Z266 | 123-309 | FTLLDDRSDVLIKKEATEVFLTTAISQNGSLDGLFVLVSLVKLIWKIVHMYEARPSLKRIVSLYSNVAATVLIARSIEDADLIEDQV… |
| A0A7X6U7N8 | 1-225 | None |
| A0A8B0T972 | 108-360 | None |
| C7N757 | 168-380 | None |
| W0FID9 | 132-349 | None |
| A0A1M7SLE2 | 141-408 | None |
| A0A2N5ZKV4 | 75-287 | None |
| A0A7V6J245 | 4-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.