DPCstruct | MC62720
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 109 ± 18 aa |
| Standard deviation of domain lengths | 17.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L7SGC8 | 13-124 | FHPDAYRFINDALAVAQEEYGRDKKQEKGGHILPRELLEGVRRLGQRRYGMMALAVFRNWGMTSTADVGQIVFEMIDLGEMKKTEED… |
| A0A7Y2FFX7 | 5-95 | LEAITFTQQSFEAPRHVTGQQLLDGIREYAKEIYGPTACMVFAHWGATETLDFGRMVYALIETGQVSKQPEDSLEDFREYYDFKEVF… |
| A0A7T9E5H3 | 1-125 | None |
| A0A3M1TR09 | 21-130 | None |
| A0A2J0LN17 | 53-170 | None |
| A0A1V5UWS5 | 30-160 | None |
| A0A257QA76 | 2-99 | None |
| A0A3D1FBS1 | 18-127 | None |
| A0A3A0CMV5 | 96-176 | None |
| A0A1G0WAJ3 | 19-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.