DPCstruct | MC6272
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 316 ± 56 aa |
| Standard deviation of domain lengths | 55.56 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562IKI1 | 1-244 | MPYDASTTKATGGLVSGMRPAIHRLQSLGHDPALGFLYGVADLMHGTGTYIDKAGKLVQVATDHDPVGLITALITQVRHLLSDVYTP… |
| A0A3P1ZRF5 | 23-331 | KVDAFTNSSVQKVAKWSGWPGAREGKDSTKSAIAWLERNYPVNYDFGTSSSTGNAVKNMTLKNHHLKSLGHSPDIIGLLFSILDQFN… |
| A0A1G5S6H1 | 71-441 | None |
| S2ZYQ1 | 44-424 | None |
| A0A7C6HU28 | 137-498 | None |
| J4RNH2 | 109-469 | None |
| A0A0P0N8E2 | 10-303 | None |
| A0A2N2E2C8 | 24-439 | None |
| A0A1V5M3E7 | 3-251 | None |
| A0A373PQ92 | 7-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.