DPCstruct | MC6270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 104 ± 10 aa |
| Standard deviation of domain lengths | 10.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.77 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | PF04287- CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832HGT2 | 379-480 | DVYQRAQAIVGQLKEAMLDAGMWPGDKPAGEIEVKGAFGSENMSFAQWLAWVLIPRVEAIVEERGAFPSESNVAAYAVRELDGVSGG… |
| A0A0P9I1A9 | 2-92 | IIQLLDELSDTLKVHQLWSNTPPNTAAFASTAPFCYDTMRFEQWLQFVFIIKMKQLIAANQPLPKGANITPMAEQMLGDYPKVIDVI… |
| G8LCL1 | 24-140 | None |
| A0A4P6AP65 | 5-92 | None |
| A0A3T0K7H0 | 15-121 | None |
| A0A4Q0YPQ3 | 16-132 | None |
| A0A432RQI6 | 2-93 | None |
| A0A3D5KQM3 | 1-104 | None |
| A0A1C3H2K4 | 3-108 | None |
| A0A4R7PCJ0 | 3-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.