DPCstruct | MC627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 7.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B2M5L8 | 392-488 | GAIGLANNWFWLDWFGYFNVAHESWTYHQQNHWLHPIGDNPENIVFWDSGMEAFWWTSSSFYPFAFRFSDGCWLYYQKDSMDPRRFY… |
| A0A7X8Z243 | 58-155 | GWDAGYTAIGGGWRRLGWFGDYVPMSDWIFHNKHGFWYPAPSSTPQNIWFYTQDMGWLYTSSTQYPFLYRANDGAWLWYNGSTNPRW… |
| A0A2E4AYB7 | 1-93 | None |
| A0A2E4ZUH9 | 1066-1160 | None |
| A0A2E4ZYA5 | 289-384 | None |
| A0A2E6TBD8 | 742-839 | None |
| A0A2E6THP7 | 694-797 | None |
| A0A496Q272 | 209-324 | None |
| A0A6B2M5E8 | 14-105 | None |
| A0A3B9FLV3 | 203-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.