DPCstruct | MC62698
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 101 ± 23 aa |
| Standard deviation of domain lengths | 22.83 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 95.11 |
| Assigned Pfam label(s) | CL0137- PF01016- CL0105- PF18471 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5BTH9 | 381-485 | SDVSGGGLSLMFRRWATKKTAGSTKNGRDSKPKYLGVKKFGGERVIPGNIIVRQRGTRFHPGNYVGMGKDHTLYALKEGCVKFERHK… |
| A0A3G6Z234 | 2-65 | LGVKVYGGQTVTAGNIIVRQRGTEFHAGANVGMGRDHTLFATADGVVKFEVKGQFGRRYVKVET |
| A0A5J5UUZ2 | 2-70 | None |
| K8EBJ4 | 819-909 | None |
| A0A368PTC6 | 1-106 | None |
| A0A444X5G7 | 33-146 | None |
| A0A177WBE4 | 10-113 | None |
| A0A0M3IDM4 | 104-237 | None |
| A0A3B0MUH6 | 8-92 | None |
| A0A7R9L0X0 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.