DPCstruct | MC62697
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 185 ± 28 aa |
| Standard deviation of domain lengths | 28.20 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847AVA8 | 145-326 | FLYFILLIIIGYYKNQKSFKGYGRIFKYSGKLKTDYTELIGYGLTFINMGIMGLICMFFVFFTSGVFNGPIIGGILTVVGFSAFGNH… |
| A0A511J1Q5 | 13-161 | KSAYHQPSFINCYQVAIIALFYSGYLITIDAPFNGFVFGSLLTVIGFCFSGITLKDLFPPFLGVLVIQILSPENLINSQEIVSLVLF… |
| A0A511J1M5 | 12-236 | None |
| A0A847G0R9 | 17-198 | None |
| H1D6G9 | 129-335 | None |
| A0A828TVS7 | 49-251 | None |
| A0A7X7DRN1 | 187-371 | None |
| A0A7X6UF14 | 4-120 | None |
| U4KLM7 | 203-422 | None |
| F9EP96 | 2-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.