DPCstruct | MC6269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 183 ± 35 aa |
| Standard deviation of domain lengths | 35.13 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3WTP0 | 180-384 | KEYEDTFKQKAIELEQKSSEYADLIETKTKSIEELNLEYNNTKTSVDNLNSQIITLDGDVSMQGFGIYKSEYNLMNSVKCSTMLAEI… |
| A0A4R0DV36 | 82-209 | LDELIDGYKHIDAAIHLKEVRRKIKNAIEYNCVGDCDYVEEKRRLSAIALVTHVFNSKADLYLSRLRHDNMGELIQSLQDDFILINH… |
| D9SPZ7 | 261-497 | None |
| A0A7K1L421 | 251-452 | None |
| A0A7V4HEQ2 | 21-177 | None |
| A0A0K3BRB4 | 7-154 | None |
| A0A2P1QP33 | 2-150 | None |
| A0A4V3R9X3 | 35-235 | None |
| A0A2T4KSR4 | 185-412 | None |
| A0A2X4U2B1 | 160-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.