DPCstruct | MC62688
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 131 ± 28 aa |
| Standard deviation of domain lengths | 28.18 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 48.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6LX07 | 30-140 | MKYVSVWRNNNKITKLKKSNISGNYNEWIPFTDNHNNPIQIGKKKDNYKGARAVIGGSNNHLLFITYYPKNISVFDLNTFRFIKHDH… |
| X6P8Z8 | 80-229 | TLLSFGGDHKHTLVMKYISVWEDENRIKKTQNANQWVPWIDANNKKISIGRLQDDYYGVRAVIGGSNNNLLFITYCPNNIDVFDLNA… |
| X6PDN3 | 1-194 | None |
| X6LZ33 | 581-719 | None |
| X6LSI2 | 160-305 | None |
| X6LR11 | 100-202 | None |
| X6LLD1 | 30-174 | None |
| X6LJZ7 | 86-191 | None |
| X6LJX1 | 371-516 | None |
| X6LDB7 | 76-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.