DPCstruct | MC62686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 206 ± 24 aa |
| Standard deviation of domain lengths | 23.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6LPJ2 | 1-180 | MVPYKHTIGIERNSLPKSGPFQDNIISLKKINLIHYLQVKLTRNNYLQKLLHELIKNGYLNDLISKKILSTGKDVVKQQMNYNEQNS… |
| X6NMF9 | 209-401 | MVSHKYTICIERNNISKSIKREDITSPKEKHKFNPLLYECDIYKLKKMQDTVSSIDPSNNELKLLLHEVIKNGYLIDLIERQQENED… |
| X6LAJ3 | 215-414 | None |
| X6P5X7 | 397-590 | None |
| X6NFV1 | 282-470 | None |
| X6NDP3 | 1-232 | None |
| X6NIR2 | 74-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.