DPCstruct | MC62682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 137 ± 13 aa |
| Standard deviation of domain lengths | 12.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.13 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF10367- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2LM33 | 158-280 | MGLYENSVDLALEKGDLELAKINADKPEDDQPLRKKLWLKIARYVVQDKKDIKTAMRFLDDTDLLKIEDILPFFPDFVVIDDFKEEI… |
| A0A034W6G8 | 21-157 | KMWAAAVDLALEFDLKLAKETASKPTKEEEREKMWLAIARHEIQGTNDVKKALDLLKECDLLRIEDLLPFFSDFEKIDDFKEPICAA… |
| A0A7R9U7K7 | 136-255 | None |
| A0A4U5NTR8 | 183-324 | None |
| A0A131ZX45 | 35-178 | None |
| A0A7J7N7W9 | 500-657 | None |
| A0A7J7H887 | 720-863 | None |
| A0A7S4L7C0 | 239-372 | None |
| A0A0B1T1F8 | 359-510 | None |
| F4QB90 | 272-393 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.