DPCstruct | MC62681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 97 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 50.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X6LFS1 | 1-103 | MLWNGKWKDYECVFDYEHRTIMLFDENKLKIKSLQLGNPNKLSLEFNVHIQWYNDTDINDTYTKWACLILNHTWHFRAIDIENRNDL… |
| X6P5H6 | 1-88 | MLKNGKWRNYEIAFDYEHRTIMLFDENKLKIKSLQLGNPNKSSLEYNVHIQWYNHIDINHTYAKWACFILNHTWHFRTSNSQEREDFS |
| X6PFK6 | 1-107 | None |
| X6LZ85 | 276-379 | None |
| X6PAW6 | 25-111 | None |
| X6MUQ5 | 171-261 | None |
| X6P5Y4 | 166-266 | None |
| X6NXI3 | 265-361 | None |
| X6P6I3 | 199-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.