DPCstruct | MC6268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 50 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 58.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3RMM1 | 108-157 | AGAFRSVSTSTTFVQGRRITTRRIMENGQERVEVEEDGQLKSVTINGIPD |
| A0A673UDM5 | 1-50 | MGNLKSMSPCTKIVNGRKITTKGIVQSGQERVEVEEDDRIKSLMINGKER |
| A0A2I0TUC0 | 100-149 | None |
| A0A7R9Q741 | 51-100 | None |
| A0A6A4W2F5 | 329-378 | None |
| A0A674JWI9 | 17-60 | None |
| A0A1J1IFY0 | 817-865 | None |
| A0A3B5LS90 | 2-62 | None |
| A0A834EGH4 | 81-130 | None |
| A0A091E6Z8 | 31-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.