DPCstruct | MC62671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.79 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6N372 | 3-99 | DSKKLYPRTGDTQTIYLKNAITSPDIVVGDYTMYNDFADNPIKFEQNNVLYHYPINHDRLLIGKFCSIACGAKFLFNSANHTMDSLS… |
| A0A3D8X675 | 18-122 | VKNPNIKVGRYSYYSGYYHGHSFDDCARYLFPDRDDVDKLIIGSFCSIGSGASFIMAGNQGHRYDWASSFPFFYMQEEPAFSSALDA… |
| A0A6N8HYT7 | 4-99 | None |
| A0A7R6WFY1 | 11-97 | None |
| R9MVU0 | 27-124 | None |
| A0A2Y9BI46 | 188-271 | None |
| A0A0X1TJH2 | 1-82 | None |
| A0A2W0CEB4 | 2-101 | None |
| A0A505DF67 | 2-97 | None |
| A0A7J0B8C7 | 3-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.