DPCstruct | MC6267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 22.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10249 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1SR96 | 29-174 | TRGTFFPRMRYYVHKWFDAPATWFRESIVEPINNRNRLPYYHRRLSRVPEIDECGVNDKACFFEANEQFRLDKMVDGFILQTLRHRV… |
| A0A673UBR5 | 16-143 | HILVPLPQTSMLNLITYLTKFTEWQHVKNRYYYYHQEFSHVPDITECQEKNVLCMFEAEMQWRRDCTVDQEIINIIQERLRGCQQRE… |
| A0A1A9XL36 | 79-234 | None |
| A0A7R9FRX5 | 2-133 | None |
| A0A5S6QIP7 | 32-178 | None |
| A0A834NUL0 | 4-145 | None |
| A0A0M3IGV3 | 36-191 | None |
| A0A183SBL0 | 23-157 | None |
| E4XW91 | 54-225 | None |
| A0A4X3PC67 | 277-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.