DPCstruct | MC62660
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 130 ± 16 aa |
| Standard deviation of domain lengths | 16.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y6FMN9 | 16-167 | TDEKITTWTDYNNNLLAIDEKITKLIENAQTVLWTGAGYPPAASTITPTKKLSECKNGWILRWSDYDPGVGSNDYDFYESPVFKQRG… |
| S4C483 | 7-150 | YRGMENGAEAIEENFDSLEKLLNKLSETNILNVGKKVWSGAWYMGENQSINPSLPLDQCLSGWLFLYQPYNTSTSLGDNWDLNYVFV… |
| A0A841YTC4 | 329-448 | None |
| A0A0E0USL1 | 106-255 | None |
| W7DJR4 | 30-176 | None |
| A0A855TT90 | 8-112 | None |
| A0A077UHH4 | 285-406 | None |
| A0A7W1T6T9 | 556-698 | None |
| A0A165XLV9 | 614-733 | None |
| R6H5X2 | 11-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.