DPCstruct | MC6265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 408 |
|---|---|
| Mean domain length (aa) | 298 ± 69 aa |
| Standard deviation of domain lengths | 69.10 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.73 |
| Pfam Score | 73.78 |
| Assigned Pfam label(s) | PF02161- CL0031- PF02159- PF00104- CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0B573 | 6-205 | ESLEFQKIWLWQQYAARVTPGVQRVVEFAKRLPGFCDFTQDDQLILIKMGFFETWLSHVARLVKDSTLTFDDGTYLTRQQLEIIYDT… |
| A0A673U5W0 | 25-311 | MNQDAVQNERQPRSTAHVRLASMESAAERRLEPLAAPRGPTPVSAARGLGHHFMASLITAETCAKLETEDADENIDVTSNDPEFPSS… |
| A0A7R9KN42 | 219-449 | None |
| A0A7R9KML8 | 42-353 | None |
| A0A7R9KJT5 | 24-267 | None |
| A0A7R9KC99 | 19-364 | None |
| A0A7R9KRQ4 | 1-180 | None |
| A0A7R9KB58 | 96-277 | None |
| A0A835CUQ7 | 311-518 | None |
| A0A835CTS5 | 217-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.