DPCstruct | MC62649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 110 ± 18 aa |
| Standard deviation of domain lengths | 17.79 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 53.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853M956 | 1-124 | MDFRGKDGQPFPAWTDAESLFEAWKKCTAGRPCDCTGLTYDKLRGGSGIQWPCNTEHPDSTERLYVDAKFWATPGYCEAYGKDLITG… |
| X0K536 | 319-420 | EFKNKEDEPLTPWTEPEEVFEAWKRLSAGRPCDYTGMSYAKLTGGSGIQWPCNDQYPVGKERLFDDGVFFTDIDYCESYGHDLQTGV… |
| A0A179UN63 | 234-354 | None |
| X7YDJ4 | 270-382 | None |
| H6RMJ4 | 93-195 | None |
| A0A0J8CH16 | 23-126 | None |
| A0A1J9R8X1 | 311-400 | None |
| A0A1G8NRR1 | 37-122 | None |
| A0A4Q4UKI5 | 532-648 | None |
| A0A0D9NQK2 | 302-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.