DPCstruct | MC62643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 74 ± 17 aa |
| Standard deviation of domain lengths | 17.02 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 73.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287U5D2 | 224-290 | DTWEVRCVCGAQDDDDERMVACDACDVWHHTRCVGIADSEAVPPLFLCILCGGALLAAGPILEEALT |
| A0A2P2MM78 | 141-195 | MERGIERWTVHCSCGAKDDDGERMLACDSCGVWQHTRCSGIPDCDSVPARFICHR |
| A0A2U1MVK7 | 1128-1174 | None |
| A0A2G5DU39 | 428-530 | None |
| C1MLV0 | 255-347 | None |
| A0A545V2R8 | 277-368 | None |
| A0A2G2X1Z5 | 51-115 | None |
| M1A5Z2 | 185-256 | None |
| A0A7S3F672 | 376-434 | None |
| A0A1D2AFL4 | 994-1049 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.