DPCstruct | MC62638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.08 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9PB23 | 162-256 | RSECIRKITDKATDESPIDTDVVICYHGDSSTTDRQPPHYGYWGHDTCRGANIDCFWMRAPNTWKGNGDAGDNNIAMKIDGKCTYNR… |
| K9PCJ6 | 35-137 | SSAIFSRPALADRSTCVQNIARGAYQQAGGRRNVMVFNLNQSYSHGLVGDDFRRATCDGIPFGVWTFSSGTFTNRGDGGYINWTFIG… |
| A0A127Z9E7 | 6-103 | None |
| A0A0F7S7U7 | 10-100 | None |
| M9MI48 | 245-357 | None |
| M9MBI7 | 30-169 | None |
| A0A5C3LLY9 | 161-277 | None |
| M9LQG9 | 3-129 | None |
| A0A7W7CCG7 | 22-120 | None |
| A0A563VWL5 | 43-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.