DPCstruct | MC62636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 188 |
|---|---|
| Mean domain length (aa) | 248 ± 39 aa |
| Standard deviation of domain lengths | 39.12 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.67 |
| Pfam Score | 99.36 |
| Assigned Pfam label(s) | PF01544- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178EC87 | 10-294 | RALAEFAQKISELTQTAVDNRKYVLVEKLQAWMREPSSSQLDKQYRTNTERLLRAAYPTKDFLPIEPWRINGKGHKCSLVVFSILLD… |
| A0A446BQB9 | 2-229 | WRQIKGIEVTSEFRGVKFRFVPEGSLASVMSKEAIREELDDDDLPWTPELDCLVNFIHSRAQKLFAITVRYVGLTPLELRKAMKAFM… |
| A0A3L6NDZ3 | 25-238 | None |
| A0A1Q5TMA2 | 140-393 | None |
| W2RYR9 | 9-242 | None |
| A0A010SBM6 | 52-351 | None |
| A0A423VFR6 | 27-271 | None |
| A0A6A5R0Y7 | 20-234 | None |
| A0A4Q4W6P5 | 15-216 | None |
| A0A3L6N4M6 | 21-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.