DPCstruct | MC62635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 367 ± 70 aa |
| Standard deviation of domain lengths | 70.19 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0S341 | 500-860 | MPTHNVLPELPPRKLCYGPRGFLLGKSPEDDLVDRELDAPYPEPWAGSYEETGLDITLMTAEQRYGPYGFGEDKPEYNRSRVEWDKI… |
| A0A446BF01 | 16-291 | GLRSLPKYESRDYTSQYHKVEPCDLDKAKKVPVPDDWAYSGVVQGQAEPVFGSHSLLGLKDDACFDRFGRYGPYGLGYSSEVVLSSV… |
| A0A0F4GNP3 | 23-417 | None |
| A0A4Q4UZE7 | 488-792 | None |
| A0A094HSS2 | 363-779 | None |
| A0A0F7RX89 | 56-381 | None |
| A0A423VBW8 | 486-825 | None |
| A0A1V6X5K9 | 3-373 | None |
| A0A5N6KYZ4 | 1-375 | None |
| A0A6A6PJN0 | 120-595 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.