DPCstruct | MC62631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 113 ± 27 aa |
| Standard deviation of domain lengths | 26.96 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 68.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.95 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 42.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4AIR7 | 1-106 | MSHLQSSGRGGAGNIVDSSKAPQLQPSDLQTPTLKTSRVTTGRGGTGNFAAGLDAEEKRRRQDVEPVVRRLSHGAVTHIGRGGTGNA… |
| A0A2G5HDL2 | 5-144 | NQKPTLTGRGGAGNLNTRPQAKLQHSDLETPTIKSTTYTTGRGGSGNMAKNDPSNASEARQAQDVDTPAHHNKEMEGTYHWGRGGQG… |
| A0A2T0FNT7 | 2-82 | None |
| A0A094FZ74 | 27-139 | None |
| A0A2B7WKQ9 | 3-108 | None |
| A0A2C5Y8B1 | 7-119 | None |
| A0A1G4JQ44 | 1-153 | None |
| A0A0G2EIS6 | 1-77 | None |
| I2H1P8 | 1-142 | None |
| A0A421JIE3 | 52-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.