DPCstruct | MC62630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 2 aa |
| Standard deviation of domain lengths | 1.84 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 92.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 39.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0M702 | 275-348 | FARHVAKHAPLVRAIIQGLTATDGHTLREGFFLDQLRRGCSAEEARNQLETAIDGGRYAELYDYGRDGARLTLE |
| A0A2X1RR68 | 103-174 | FARRLLEKVPLARYIRRVLDEKIGHRVSEERFLSKLEDYLSEKESERVLRTMIDWGRYAEIFAYDFTSGILS |
| A0A847VNG1 | 195-270 | None |
| A0A149VFS8 | 153-228 | None |
| A0A118G5G3 | 22-94 | None |
| A0A3G9G5H7 | 54-129 | None |
| A0A328VAX6 | 289-364 | None |
| A0A378IYC5 | 65-136 | None |
| A0A1J5PKB9 | 164-234 | None |
| A0A7T6VMS1 | 3-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.