DPCstruct | MC6261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 182 ± 43 aa |
| Standard deviation of domain lengths | 43.39 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167P095 | 5-126 | QKATFEAFSKYDFDNDTRFQSGVSSLMNRYKKESIDSDDILERAQWFYYTKFVEPFDLDAFREWKAKKEADVDQEQKRFTFQELVEM… |
| A0A3M7IY84 | 1-184 | MATESSNDLNSNTYLFNQLDSYPWDEDQEFQGGLQAILGSVQDPAQVEHLTLRAKCYFYARKAGTHVDFDGYKKWVENGHSDPNAGS… |
| A0A2B7WML4 | 33-277 | None |
| A0A1Y2DY21 | 13-245 | None |
| A0A3N4IKR8 | 2-151 | None |
| A0A099P334 | 77-257 | None |
| A0A1Y2HK64 | 20-156 | None |
| A0A4S8MHM1 | 5-172 | None |
| A0A0C3B1R3 | 1-140 | None |
| S2JPC6 | 6-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.