DPCstruct | MC62607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 83 ± 14 aa |
| Standard deviation of domain lengths | 13.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 56.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3BLG9 | 256-330 | ETLESVKKCKNFLVTLIKLASSDSRSANMANNVRGLVRSLLEGKMEAEEFTELLYEELKSTPQPCLVPFLKKSLP |
| A0A2R7X928 | 1-86 | MNNVVQQSRGAIDQTKEKCRKFLANLLELSSREPKPVEKSVRTLIQELVDVKVEPEQFCDRLERLLNASPQPCLIGFLKVFLFLSV |
| A0A833RWS5 | 35-113 | None |
| A0A443SNM5 | 245-321 | None |
| A0A6A5FAF9 | 130-234 | None |
| A0A811UXN0 | 381-459 | None |
| A0A182MR06 | 153-230 | None |
| V4AI41 | 1-74 | None |
| A0A3L8S570 | 149-237 | None |
| K7F3R2 | 146-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.