DPCstruct | MC6260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 131 ± 3 aa |
| Standard deviation of domain lengths | 3.44 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9QRN3 | 26-154 | RAMRIAEILSDFRHLQHAIANIRANPSAEEYYEEGYCVLRQCAAEAQALLNQPFDCQGPEPDGDGEQEKAQLQRVMLDASIRRFKIQ… |
| A0A3M7IV23 | 4-131 | RALRVAEILNDYRNILDYLSAIRANPSAEEYNEDGYVVLRKCVTQAQALLSHPFRTQGGSRGDEEINKAHLRRIISDAAVRRFKAQK… |
| A0A0S6XCX7 | 4-132 | None |
| A0A6A6U259 | 35-162 | None |
| A0A423VU36 | 15-145 | None |
| A0A5N6K0H2 | 5-142 | None |
| A0A1B8GM78 | 153-284 | None |
| A0A4S9QF20 | 4-128 | None |
| A0A364KLR5 | 5-138 | None |
| A0A093ZS72 | 95-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.