DPCstruct | MC626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 150 ± 30 aa |
| Standard deviation of domain lengths | 29.65 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q01VG7 | 1-104 | MISEKRSQAARANGARSRGPVTPEGKAISSRNALRHGLLAATVVLGNEDAKTFEGVFYMLIERFSPVDDIELSAIEEMAASHWRLRR… |
| A0A7X8UTC6 | 6-164 | PISARKRAANRRNAQKSTGPQTPEGKAVVSRNAVRHGLLAQHIVLAEDPNENPADFNQLLEQLMDQYRPTRTVASLLVERLAAGFWR… |
| W3RJQ2 | 1-135 | None |
| A0A257VFV0 | 1-183 | None |
| A0A1Q8QTM5 | 7-143 | None |
| A0A6N6S059 | 32-193 | None |
| A0A317HME3 | 1-182 | None |
| A0A2U3L8G0 | 57-191 | None |
| A0A2U3JXW6 | 4-127 | None |
| A0A537V404 | 1-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.