DPCstruct | MC62599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 328 ± 48 aa |
| Standard deviation of domain lengths | 47.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9RBQ7 | 4-260 | PSLLGLPTELLLLLSGHLYSLKDLYTLVLTSKRLYYIYKDTSKHVLRLAVKSPLLEPSPHFLVAFTARRVADWAVQSNERKQKLHQT… |
| A0A4Y9YZ11 | 9-337 | SLLSLPEDVLLTLPHYLRDIEDFINLAATCRLLHNLSLHTLPRTILRLAAAASRTFFRPDPCFLVAATARQVGEWASRSSENTAELR… |
| A0A1C7MQU6 | 1-213 | None |
| B8NPT3 | 1-346 | None |
| A0A1L7WYL9 | 1-348 | None |
| A0A6A6BMF4 | 10-386 | None |
| A0A084BCE4 | 3-350 | None |
| W2RQX2 | 4-370 | None |
| M7TP43 | 254-569 | None |
| A0A5M9MAL5 | 1-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.