DPCstruct | MC62592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 148 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 50.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0JE85 | 1-152 | MVEAYNGNNFLKGFDVDERSVVSHLFHQWAKRQAFKDPKRLLGKVGFVIDERLRVQKNKHKDVLRALKSCLNSDEAFQYAEYVLRWE… |
| A0A534SED8 | 3-129 | NYFHYAVRSGDTSPTAVVQAVAAEVQKRFQWTVDQPRRQWLHEVLHAIRSDPDAAHAYAETVLAWEQLPYAARQQQKVARAVPFLAE… |
| A0A811N898 | 1-177 | None |
| A0A445BH39 | 513-662 | None |
| A0A2Z6LKC5 | 190-339 | None |
| A0A6J0NLH6 | 818-964 | None |
| A0A7S4NW85 | 253-412 | None |
| A0A7S4L1D7 | 606-767 | None |
| A0A7C9D3Q9 | 135-260 | None |
| A0A0R0EQM1 | 1618-1744 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.