DPCstruct | MC6259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 178 ± 20 aa |
| Standard deviation of domain lengths | 19.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7PZ56 | 1-166 | MLPVARTRDEARLYLDLTPCTCGEVDADWQHATGLLDGELVSVYDATCPNCDAEREYTFGLPEHEIAADYPNFGGAEPSQLIDPGRW… |
| A0A7W7WTD9 | 227-429 | AAAPLPARTYAEIHTYLDTHPCRCGSVEFSRDQMAVLTSDENGVVVGYSGPCDDCALPRDQVFRLPQRPGSLPGEPWRFSYPEDGPS… |
| A0A4Q7W8B4 | 4-215 | None |
| A0A1M3NHY4 | 1-179 | None |
| A0A654ZW73 | 100-261 | None |
| A0A0P6VV94 | 179-361 | None |
| I8ZZV7 | 37-236 | None |
| G8S813 | 1-177 | None |
| G8S812 | 1-138 | None |
| A0A7W0V980 | 89-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.