DPCstruct | MC62585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 213 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7VXQ2 | 189-402 | MVTGDPHRTPTFTGFADPDYFVFAGAPNCASPCVTVQPGFAWNHGDFSPDINVTWLGMVGPGIKHLGVTNSVWSDHTDIRPTILSLV… |
| A0A535N8N3 | 459-671 | ADPNRTPTFTMFGNPDFFFQTFAPNCGANPCVNPKFAWNHGDIQAEIGTTWSGLVGPGIKQGGIDAQTWTDHTNLRPTILTLLGLKD… |
| A0A1Q7M0K0 | 1-190 | None |
| A0A536EFY9 | 221-448 | None |
| A0A535UME2 | 77-288 | None |
| A0A535R142 | 105-318 | None |
| A0A537WFD5 | 377-597 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.