DPCstruct | MC6258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 51.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H3T2E2 | 37-119 | RAWGAGKTGRALQADLLSATWPPPWGECDGDDAYPTASDVRATIGYALENGWPPAARGGTLVLTEHEHGDRFGLPGFLLTDRL |
| A0A7W7WRK1 | 1-96 | MRIWGAGKNSQALQADLVSTAPPTPWGNPCLTDGTYPTPREVLTVIDHALAHGWQPDALGGTFVLTEAQHAHTLQLPNFTLTDRLAI… |
| A0A229S7N4 | 1-99 | None |
| A0A2R4FJK1 | 39-120 | None |
| A0A840VJU2 | 37-112 | None |
| A0A1E7KDW7 | 37-123 | None |
| A0A239D1U7 | 38-116 | None |
| A0A543CKF0 | 1-81 | None |
| A0A7Y6I721 | 365-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.