DPCstruct | MC62577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 223 ± 38 aa |
| Standard deviation of domain lengths | 38.38 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01992 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847ATT9 | 110-330 | EASNILINTGSIDVKNLKYSVKERDFLALTENMGNALKEIIEDFPKTNDPQIIDIILDKYCYDEMLKSAKSTNNQFIIDYVRMQIDA… |
| A0A662RS90 | 64-278 | EVGSLEDAIKRFEEPYRGILADSIQDYKNKMSNRHRLLDLENALDRDLFGAIWDKKEHLRRADREIVEKVIGTELDIANLMTMLRCK… |
| A0A4V3WIS0 | 86-343 | None |
| R7QLV0 | 186-445 | None |
| A0A7C0XRQ2 | 22-240 | None |
| A0A3N9P2E4 | 150-406 | None |
| A0A6V8DIG5 | 27-234 | None |
| D2MQM2 | 37-296 | None |
| A0A7X8GHT7 | 51-284 | None |
| B7P918 | 253-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.