DPCstruct | MC62573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 6.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 32.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2KQU0 | 200-309 | VYLKSQGVDFRLNTKIRDIVTRLDSGTVSISGICALRDGVEEIITVSPKDIVIISLGSTTSGSSSGTNKDPPLKMTKIGRFGSIWQR… |
| T0E1B7 | 72-171 | KFTKYNQYESLILPMVKYLESNGVHFQYNTTVTNVKFEITKDKKVAKQIVCIKDGKEETIDLVEDDLVFITNGSCTENSSLGDDDHA… |
| A0A7W3UXL5 | 70-174 | None |
| U6F3L0 | 136-240 | None |
| A0A401KYK8 | 2-99 | None |
| A0A1L9VPS8 | 138-248 | None |
| E4HLF3 | 26-130 | None |
| A0A2P7P355 | 11-101 | None |
| F3Y8P1 | 34-134 | None |
| A0A4S3JWC3 | 62-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.