DPCstruct | MC62569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 97 ± 13 aa |
| Standard deviation of domain lengths | 12.58 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7YPV0 | 2-92 | LAVGLSAAAVWFLAQAMPMGTGYVARYLCSSTFISGRDPKAVFNEDVKPVNPLAGVVAWDVDADDQSVTATAFKVFRSKAIYRAGCG… |
| A0A800F0C9 | 8-96 | LFIVLLSGFIYLWLNLFPIISGFGAKALCSCAYVGQRNVQDVIDKELKAFPLSLGTFSLSESDSSAVGSVWGLAKAKAIYTKGWGCT… |
| A0A2A5CQS6 | 7-106 | None |
| A0A2D5WY86 | 26-112 | None |
| A0A4V1LT11 | 24-114 | None |
| A0A6I7PVC6 | 32-129 | None |
| A0A820BFE6 | 10-100 | None |
| A0A6F8NCB0 | 54-159 | None |
| A0A0F2QJ14 | 8-82 | None |
| A0A7W9AWV6 | 12-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.