DPCstruct | MC62567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 148 ± 18 aa |
| Standard deviation of domain lengths | 17.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.52 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0291- CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W4IWF0 | 4-139 | AQRTDLEYQFRVVYTLDAVSKSRANFQFVLPESAEGKEIRNVLVQHKLADHLYPHKPGDIISIIQQKTGKTFTQRNHTQAWRMFEVR… |
| D2TZ08 | 1-110 | MNINKLNIEERRNYEQGITFIKELENPYKLKPTKVIELVRKKIIFFNRYWHTKCWQYFKTRPSNIDIYFKNSYVAYSEGFDGYLYSK… |
| A0A451C6H1 | 566-728 | None |
| A0A4Y3N8Y6 | 3-130 | None |
| A0A4P8L2Q7 | 1-119 | None |
| A0A7V4XB59 | 248-416 | None |
| A0A7V5KXT7 | 8-147 | None |
| A0A133Z1Y7 | 106-242 | None |
| A0A7V9UDW7 | 3-151 | None |
| A0A7T9FFQ5 | 122-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.