DPCstruct | MC62563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15657 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y8N626 | 22-90 | LGENHQPIKTREYTFTREDGSQIVIQDHWPGHSYGPAGTPGNQGPHVNVRPIEDTRNGTVPGTLEHYPF |
| A0A4Y9FIK4 | 83-152 | LDSEFRHINTREYHYENKDGKIIVIQEHSAGHTYGPEGTVGNQGAHFNIRPIDDLRNGKIDGTRSHYPFQ |
| A0A4R6JZ98 | 512-579 | None |
| A0A7Y0A0H4 | 37-98 | None |
| A0A2B5PRC9 | 14-75 | None |
| Q7N2G3 | 8-76 | None |
| A0A5P1D7E7 | 18-83 | None |
| A0A4R4ING8 | 2-74 | None |
| A0A414XBT8 | 164-240 | None |
| Q81H92 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.