DPCstruct | MC6256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 8.05 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I6X3X9 | 444-538 | HMPMIEISCPICDTTTKTLPRYPRRVCGTCAAKASDESGRALEFFNTSIGGGFIAYYADSHQTETHPGHLCFIDGIRCYADEARFGG… |
| A0A3M2LDW6 | 3-91 | AQRYPRAVCDDCRARTTDRAGRRITGYNTSFSGGMIAYYTDTLGEPNDPAAREECVEVTRTGLCFIDGVAATMREARFGGIVVQLGD… |
| A0A519N687 | 129-217 | None |
| A0A418M3T8 | 34-125 | None |
| A0A1M5I781 | 216-309 | None |
| A0A7C5C9M0 | 4-97 | None |
| A0A2G6CFU3 | 35-129 | None |
| A0A3M0ADW9 | 169-265 | None |
| A0A4Q5LNK4 | 13-105 | None |
| A0A4Y7ZMP9 | 3-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.