DPCstruct | MC62552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 289 ± 40 aa |
| Standard deviation of domain lengths | 39.54 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5T578 | 1-202 | MDVSCETCHRTIPATTSHHLHRETVDCTACHTQSVISCYNCHFESEIAAGIKRPYGVLRNFTLLVRRQGSGKVYPATIMGLTYQGKS… |
| A0A7C4ZB89 | 107-405 | TIRTSLHGSGVGKRVWYWAENGGFEGISGKTYEELACKGCHQPKCDNCHEAAGSPVPQSKCEGCHGRQMAEVKQGYSDVHRDKGMGC… |
| A0A7W0EHP8 | 87-436 | None |
| A0A7C1D288 | 5-266 | None |
| A0A1F9BAY6 | 7-225 | None |
| A0A656DAE6 | 1-235 | None |
| A0A7V3HKK3 | 146-443 | None |
| A0A357ZK95 | 135-405 | None |
| A0A6H9KDA1 | 4-315 | None |
| A0A1G0THK1 | 25-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.