DPCstruct | MC6255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 132 ± 14 aa |
| Standard deviation of domain lengths | 14.37 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D9TMS2 | 4-123 | IHESNLLLLDQVIFEHDELMKDMKELKDLKTKLESLEESDGNIDIAINNLDEARKGMMSFMKDFSEEFPFDSYPMQKDAREGLESKT… |
| A0A6P1P4F1 | 1-128 | MTSLGCDSGGVKVEKVPDKTRVDLLKDQVMAKHDSAMARYGDLYVQRKRLSQQADSLPDTSVALKEQYGKTILELIKADDAMMQWMR… |
| A0A1W6MKT5 | 2-154 | None |
| A0A2T4XCW0 | 6-148 | None |
| A0A839GE90 | 115-259 | None |
| W8VQ89 | 3-149 | None |
| A0A3B9AMG7 | 5-132 | None |
| A0A4Q9BAJ6 | 4-122 | None |
| A0A4Z0P3J0 | 5-115 | None |
| A0A368JSA2 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.