DPCstruct | MC62542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 9.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 56.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2GGB2 | 1-63 | MIIPVRCFSCGKVIGNKWDHYLSLLQADFSEGDALDSLGLKRYCCRRMVLTHVDLIEKLLHYN |
| A0A1B9I904 | 41-104 | MIIPVRCFSCGKVIGNLWDSYLELLAAGVDEGDALDRLQLKRYCCRRMVLTHVDLIEKLLMYNP |
| R9NWH6 | 128-192 | None |
| A0A5S6QLJ0 | 169-228 | None |
| M9LJ43 | 19-90 | None |
| A0A7G9Z2R2 | 12-78 | None |
| A0A835H1R3 | 1-70 | None |
| R7Q867 | 77-144 | None |
| A0A7D8UYG7 | 1-70 | None |
| A0A077RWJ0 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.